PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 438630
Common NameSELMODRAFT_438630
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Lycopodiidae; Selaginellales; Selaginellaceae; Selaginella
Family HB-PHD
Protein Properties Length: 583aa    MW: 65119.2 Da    PI: 4.5432
Description HB-PHD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
438630genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox382.8e-12453500754
               --HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
  Homeobox   7 ftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRak 54 
               + +e +++L  +F +++ ps++++e +Ak+lgL+ r+V vWF+N R++
    438630 453 IPPEAVQRLRVAFDRDQLPSRDSKEAIAKELGLSYRKVDVWFKNVRTQ 500
               5578999*************************************9986 PP

2PHD38.52.6e-13176231151
             SBTTTSS..TCTTSSEEEBSS.SSSEEETTTSTSSSSHHSHHSS..TBSSHHHHTT CS
     PHD   1 rCkvCgk..sdeegelvlCdg.CkewfHlkClglkleseekpeg..ewlCeeCkek 51 
             +C+ C++  ++ +++++lCdg C++ fH+kCl+++l +e++p g   w+C+ C++k
  438630 176 FCAKCHSheAEVDNDIILCDGfCNRGFHQKCLNPPLATEDIPPGdeGWMCPICDCK 231
             6999**976666********88********************9999*******985 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF579031.15E-13167234IPR011011Zinc finger, FYVE/PHD-type
Gene3DG3DSA:3.30.40.101.7E-12174231IPR013083Zinc finger, RING/FYVE/PHD-type
PROSITE profilePS5001610.887174231IPR019787Zinc finger, PHD-finger
PfamPF006287.9E-11176231IPR019787Zinc finger, PHD-finger
CDDcd155042.08E-31176228No hitNo description
SMARTSM002492.5E-9176229IPR001965Zinc finger, PHD-type
PROSITE patternPS013590177228IPR019786Zinc finger, PHD-type, conserved site
PROSITE profilePS5007112.811444504IPR001356Homeobox domain
SMARTSM003891.3E-10447508IPR001356Homeobox domain
CDDcd000861.45E-9449504No hitNo description
SuperFamilySSF466893.93E-11451508IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.607.3E-13452510IPR009057Homeodomain-like
PfamPF000461.1E-9453500IPR001356Homeobox domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009733Biological Processresponse to auxin
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0005515Molecular Functionprotein binding
GO:0008270Molecular Functionzinc ion binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 583 aa     Download sequence    Send to blast
MGRRSQKSAN ANREGGAAGE EEATHKPRKS KSGRTGSKGG RPRTRDQEEP CSSSRAEAER  60
EARRRRKKMR GTPIGHCVSN ADATATAKIM KQVKYYFNSM KLEQSFIDAY ANDGWKGQSR  120
EKVRPEKELE RATAKILGWK LKIRKAVQEL DKMCLEGSIL DSAFDADGQL DYQEIFCAKC  180
HSHEAEVDND IILCDGFCNR GFHQKCLNPP LATEDIPPGD EGWMCPICDC KSDCASFLND  240
HLGTDFDVEM SWEKFFPEAV EGSNTIVADD AVQDLPSEDS DDDDYDPDNK DKEQEKLANG  300
KGAKANEAGE EQDQAGDDDD ESDDSGGDDS GGGDGSDSDD GTTDLSGEEP LSAAEEDEDE  360
KEKEGDEEGG GSKKDSDEVS GKRRRRDVDY RKLHDEMFGV EYEWAEAFQS EDEDYGPLKR  420
PRKQRSERKT DRNEQNQDHG ENQDGFSDKS KRIPPEAVQR LRVAFDRDQL PSRDSKEAIA  480
KELGLSYRKV DVWFKNVRTQ ALKKAKSDEA ENQTLLTQVG QAELKLEDLK RAMEAVRHLE  540
VLKLSSYAQG FYENSVVDVN RGKRLVYMPV AEVVEQGGTN PL*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
16369RRRKKMR
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002963483.10.0hypothetical protein SELMODRAFT_438630
TrEMBLD8QX610.0D8QX61_SELML; Putative uncharacterized protein
STRINGEFJ353540.0(Selaginella moellendorffii)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP18301539
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G19510.12e-73Homeodomain-like protein with RING/FYVE/PHD-type zinc finger domain
Publications ? help Back to Top
  1. Banks JA, et al.
    The Selaginella genome identifies genetic changes associated with the evolution of vascular plants.
    Science, 2011. 332(6032): p. 960-3
    [PMID:21551031]